SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488606401|ref|YP_007920161.1| from Burkholderia thailandensis MSMB121

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488606401|ref|YP_007920161.1|
Domain Number 1 Region: 39-82,113-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.13e-27
Family C-terminal domain of adrenodoxin reductase-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488606401|ref|YP_007920161.1|
Sequence length 474
Comment FAD dependent oxidoreductase family protein [Burkholderia thailandensis MSMB121]
Sequence
MTTPLDALEARLAQDLRWLDLPAPSWVPPREADGTRVLDVAIVGGGMAGLAASAELRLLG
IDNQCVIDRAPAGYEGPWVTFARMETLRSPKQLAGPALGLPALTFRAWFEAQYGRDAWDA
LYKIPRMQWMDYLRWYRRVLDLPVRNDTTLAALRPRDDGLLALDVRGSGEARTLLARHVV
LATGRDGLGGPYVPPVAQRAPRTRWAHSSEPIDFAALAGKRVGVVGAGASAFDNAGAALE
AGAARVDLFFRRADIPRINKLTGIGSPGLVHGYADLDDATKWRFMHYALTSQTPPPRDSV
LRVSRHGHAHFHAASPIETLAERADGLEVTTPRGRYEIDFLIFATGFHSDWTTRAEFAAF
GAHVRRWKDRYRPEPGAWLDELAESPDLGPAFAFQEREPGACPAVTRIHCFNHAASLSHG
KLSGDIPAISAGAERLARGIASRLFDADRDRHYDAIVAYAHAELQGDEWRDADA
Download sequence
Identical sequences A0A291CEF3
WP_015603297.1.11107 WP_015603297.1.74495 gi|488606401|ref|YP_007920161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]