SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488606872|ref|YP_007921536.1| from Burkholderia thailandensis MSMB121

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488606872|ref|YP_007921536.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.89e-107
Family FMN-linked oxidoreductases 0.00000000223
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.71e-40
Family N-terminal domain of adrenodoxin reductase-like 0.000015
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.43e-24
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488606872|ref|YP_007921536.1|
Sequence length 677
Comment NADH:flavin oxidoreductase / NADH oxidase family protein [Burkholderia thailandensis MSMB121]
Sequence
MTTPFPHLLAPLDLGFTTLRNRVLMGSMHTGLEDSRKTLPRLADYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTSSTGAAARRHRVIPDAVHAQGGKIALQILHTGRYGYHPFAVAPT
RLKSPISPFTPHELTARGIERQIRAFVRCAQLAREAGYDGVEIMGSEGYLINQFISLHTN
KRTDEWGGSYANRMRLPVEIVERTREAVGRDFIIVYRLSMLDLIPDGSNWDEVVLLAKAV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGEVGIPLVTTNRINRPEVAEQ
ILADGCADMVSMARPFLADAEFVKKAAEGRVDEINTCIGCNQACLDHAFKNRIASCLLNP
RACHETELNYARAAHAKRVAVIGAGPAGLACATVLAQRGHRVELFDAAAEIGGQFNMAKR
IPGKEEFHEALRYFARQIELTGVQLRLNRRVGAAELIAAGYDDVVLATGVAPRNPHIPGQ
DHPKVLTYIDVLARNKPVGERVAVVGAGGIGFDVSEFLVQDGESPALDLDAWKAEWGVTG
PTLARGGVMRGEAVPPARRVTLLQRKATGLGKGLGKTTGWIHRATLKMKQVEMIGGVNYE
LIDDKGLHVTFGKERVDPTLIEADTIVLCTGQEPERALLEPLKAAGVSVHLIGGAELAAE
LDAKRAIDQGARLAARL
Download sequence
Identical sequences A0A291CGM7
WP_015603662.1.11107 WP_015603662.1.74495 gi|488606872|ref|YP_007921536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]