SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26553576|ref|NP_757510.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26553576|ref|NP_757510.1|
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.21e-50
Family Class I glutamine amidotransferases (GAT) 0.0000137
Further Details:      
 
Domain Number 2 Region: 180-416
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.87e-49
Family N-type ATP pyrophosphatases 0.00000733
Further Details:      
 
Domain Number 3 Region: 389-511
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.16e-44
Family GMP synthetase C-terminal dimerisation domain 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26553576|ref|NP_757510.1|
Sequence length 511
Comment GMP synthase [Mycoplasma penetrans HF-2]
Sequence
MDKILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGD
RSIKPNKGIWDLNIPILGICYGFQVMMQENGGQVENDKDSEEYGSTDIRLTTNELFENIE
LDNNCWMSHSDSVIFLPKGFKVIASTNKCLVASACNREKKFYGVQFHPEVTQTTFGNQLL
QNFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDDYVLCAISGGVDSLVAAVLTAQAIGDK
LYCVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGKT
FIEVFEKVANKINVPFKYLLQGTIYPDIVESGSKFSKTIKSHHNVGGLPERLQFELLEPL
KYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITEDKLEIVREADFLFRSYID
QLYKNSEHKPWQYFTVLTNSKSVGVVGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLE
KISSIICNKVKNISRVVYDITNKPPGTIEWE
Download sequence
Identical sequences Q8EWS9
gi|26553576|ref|NP_757510.1| 272633.MYPE1220 WP_011076950.1.43808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]