SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26553602|ref|NP_757536.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26553602|ref|NP_757536.1|
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.45e-64
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000638
Further Details:      
 
Domain Number 2 Region: 236-319
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.000000216
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|26553602|ref|NP_757536.1|
Sequence length 386
Comment DNA-damage repair protein MucB [Mycoplasma penetrans HF-2]
Sequence
MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKK
ICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFAS
LVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGI
GPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL
GRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN
FQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESK
LEKIRKQVNKTLNKKIIHYPSSRSNR
Download sequence
Identical sequences Q8EWQ4
WP_011076976.1.43808 272633.MYPE1490 gi|26553602|ref|NP_757536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]