SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26553626|ref|NP_757560.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26553626|ref|NP_757560.1|
Domain Number 1 Region: 628-776
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.06e-33
Family Glucose permease-like 0.00016
Further Details:      
 
Domain Number 2 Region: 524-596
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 9.68e-17
Family Glucose permease domain IIB 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26553626|ref|NP_757560.1|
Sequence length 781
Comment PTS system glucose-specific IIABC component [Mycoplasma penetrans HF-2]
Sequence
MNIKTWLQKSNSTFFNMFHFKKGETKNKGKVKDFFSQLSRGLMLPIAILPIAGLLLGIGG
AIGANIPQTSDLQILANIFKAMSQVVFDSLPILFCVAITITFSKDRGTAAFSSLLAYLVF
CSIQVPFIQKENGQIVSIMWFHTNLNVVRSITTTLFGFTNLQTSIFGGILVGFLTSFIYN
KVSKIKLPTALDFFSGIRLVPIVLIPVISLLAVLFLIFWPWVGYVISIIGQNIQLAPYGT
GGLLYGILGRSLMPFGLHHIPIILAYQTDFGGVLYKQDLLNALVNNGVSTDSTIYQAINN
AFPGTSIVGDQNIWNFINSLSFNSLPNADGTQTPIFQWFVKNLNVYAGKYTQDYPTYMGA
CMGIGVALILVSKKENRKRVASVVGSAMAVAFLTGITEPLEYTFLFCAAPLYYLIYVPLS
GISYMLMELSQAHVGVGFARGFIDLIIYGAIPVVKGSNFYWAFPIAIGEGLITGFSFYFL
IKKFNFSTPGRNENNFELITKSKYKEMKNMASSSKNKNEAPERIAKLIYALGGLDNIENV
TACATRLRVSLNSSELVKVNDFKSMGSKGEFLKDKAIQVIFGGEASILSDQINDVIEGNL
SLPKDLKTENTDLNKQENKVENKKIIPFKVFAPVNGKIQYLENVDDDVFKNKLMGNGVAI
LPTSNKVYSILSKGKLVDIFDTKHCYTFESEDKTKILFHIGIDSVSLSSNPFKPVCKKDS
DVSKKSLISEIDLNLLKKAKSIASPIVLPELLENQEVKILVKNNQVIKQGDPILEIIEKT
K
Download sequence
Identical sequences Q8EWN0
gi|26553626|ref|NP_757560.1| WP_011077000.1.43808 272633.MYPE1730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]