SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26553646|ref|NP_757580.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26553646|ref|NP_757580.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.49e-50
Family Obg GTP-binding protein N-terminal domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 159-340
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-47
Family G proteins 0.0000337
Further Details:      
 
Domain Number 3 Region: 360-428
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 3.01e-17
Family Obg GTP-binding protein C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26553646|ref|NP_757580.1|
Sequence length 429
Comment GTPase ObgE [Mycoplasma penetrans HF-2]
Sequence
MLIDKCTLFLRAGNGGNGVISWRKEAHYPEGGPWGGDGGKGGDVYIIGDHNLNSLIDLRY
KKKIEAEDGENGKTKLATGKNGNDIYIKVPVGTTITNSITNEVIVDILVTGQKYLICKGG
MGGKGNAYFKSSKNRIPNLCENGELGETIEAQFELKYIADVGLLGLPNAGKSTLVNSLSN
TNLKTANYMFTTLSPSLGVVNFEDEHLVFADIPGIIEDASNGSGLGLDFLKHIERCHFLI
HLISVANIDTENPFKDYLTIVEELKKYNKEILKRKIFIVLNKIDENDSKDNINLFLKEFK
KISNKKVYQISGFFKENTNELLKDIFKDYKKHKEQWERELEEKINSYSLVKVEKEQEDIV
TYEKDENRIWVVSSKRIAYWFNRIPFNTDENVTRFMQKIKMDEIEQTLKDKGAKIGDSFR
IQDVMFEIN
Download sequence
Identical sequences Q8EWL0
WP_011077020.1.43808 gi|26553646|ref|NP_757580.1| 272633.MYPE1930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]