SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26553865|ref|NP_757799.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26553865|ref|NP_757799.1|
Domain Number 1 Region: 3-201
Classification Level Classification E-value
Superfamily DhaL-like 4.97e-43
Family DhaL-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26553865|ref|NP_757799.1|
Sequence length 573
Comment dihydroacetone kinase [Mycoplasma penetrans HF-2]
Sequence
MKSLETKILVSMFENGAKEIAKHYEYINELNVFPVPDGDTGTNMKITATSAVEALNKQLP
ELGSIYEVGKFFCRQLLMNARGNSGVIFSQIIRGFFEPIEESTKKLTIELIVRCFISAKE
KAYKSISNPVEGTILTIIREISEQLPKENINDVEELFKKALTIGLNALEKTPEILPSLKE
AKVVDSGGYGLCKFLEGMYNQLVNSDDDNVQNKDIEIEKKKETVESISVTSKNTFIQSKV
RNDISEEGFGYCCEFIIQKDFITHEKQPLKIKFDLNKFEKEMLLAGESLVVVDDSDIVKV
HIHSITPSLVFEIGQKYGEFLKLKVENMTLQYIESHPGVSPSDLFNKFSLTDDVQIVATC
PSRKIADYLKNEFGINNVIVTEETGNPSTNEIMNQIINCKSRNILVLTDDSNIILSAEQA
ATFMKERYDVVVLKSKNIIEVINACLVFSSEKSISENARVMNRAIRKQDSAMLSVSVKTS
KFNGVHVEKNDFIGIYDKKIVLAEKNSEIAITNLIKKLRDRNKKAQLLYIVYGQGVTLRE
IRNIEKFANENYGIKCKLIDGGQKIYRYFIGMS
Download sequence
Identical sequences Q8EVZ4
272633.MYPE4130 gi|26553865|ref|NP_757799.1| WP_011077239.1.43808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]