SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26553906|ref|NP_757840.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26553906|ref|NP_757840.1|
Domain Number 1 Region: 6-167
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.26e-32
Family Glucose permease-like 0.00029
Further Details:      
 
Domain Number 2 Region: 201-274
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 4.05e-17
Family Glucose permease domain IIB 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26553906|ref|NP_757840.1|
Sequence length 1020
Comment PTS system enzyme IIBC components [Mycoplasma penetrans HF-2]
Sequence
MDLHTNLKRIFMDNKKITIYAPLDCSVYPIEKIEDKAFASKSLGEGVFIIPKKGQNKFYS
FFEDATISLVADTKHAFFIKDQSSKVVGLIHIGLETVNFKGEPFNNKVKPGDKVNLNSLL
TEVDLDFLLQKKITLSTPIVFDKQENSNWQFKPIPKIGSVKRGQPIGYLEYVENKETAAN
TKNEKAVTEDGIMKSKFQVAAENIYGFVGGYTNYTNYTNCMTRFRFMVNDKNKVEVNKIK
EIPIVKGINWNGNELQIIIGGDVIRVRESFNKYLESIHVPLKDAVASKGTESKQESQQFA
TKQTKKGFRNRVLVPLVSCIMPILYVLLAAGIFKGIYSICNIIDPANFPSSMGTTFAGLN
ATAQGLFGTTIDGISGVQWFAYVLFVIGDVGINFLGILIFFSVVRYMKGDMISAMGVALV
LIAPSIYGYFDSTNGTTTSWQLAPAVPLGGGFNITYSIQSYTNSVLVCGGTGVAYVYFDR
WVKSWMPGMLDVVLRMALVILFTVVSVYFILGPALSVVQTIIGIIFNALSSIPYGIGVAL
FALLWQPLVLTGAHGAVAGVLIVQVYATQAGTSLMWGLMLGVFGQGAAGFAVAVHTKNSE
LRKQALTGFVPALLGITEPVIYGVILPKVKPFLTGCLAAGIGGLFAGIFGVASYLSGGQG
ILGVLGLVVNQAWMEKDATPINLLTGLKNDTAANLTYGVISILVVYGAALLFEFFLNKER
LQELHATKKANNFLLRTCVLKTWYLNDQKLQDTLSKLEQSKKGWDKFVLKLYLTWLINAY
KVKYLFTIKSKVNKLIMYAANVKDPNSEKGKVKIATSLKKQKDKKELAINVLKNKFNESD
FNQLLVLSNELSKATDLVTHQFILDAKAYEKDVIIDVKLNTKFNSLSDKAEKQIIKIQTK
IAKLKKQDKSDSLVKVQNLEQKLKDLNVSKKMVEVENKIDSRRENYEMLKNKLLEVNNQY
TSIVDNVLKETATYLKDEKFANLDSKHFNAIHSVDVCYGKEVAKINEYHKYQLFNINLEN
Download sequence
Identical sequences Q8EVV5
WP_011077278.1.43808 gi|26553906|ref|NP_757840.1| 272633.MYPE4540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]