SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26553913|ref|NP_757847.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26553913|ref|NP_757847.1|
Domain Number 1 Region: 44-113
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.0000000000118
Family Glucose permease domain IIB 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26553913|ref|NP_757847.1|
Sequence length 125
Comment hypothetical protein MYPE4610 [Mycoplasma penetrans HF-2]
Sequence
MKKITWYYICTFGIGYLVAKKKAKKIATTVNSELTVTNEVPFKVKEIIDAVGGIDNYLFN
STTINSIKIGVKDIELVDKEKIKKMGAVGVNLNQDSIRCLFGDFSKKLGQMLDESYPDKK
AETEK
Download sequence
Identical sequences Q8EVU8
gi|26553913|ref|NP_757847.1| WP_011077285.1.43808 272633.MYPE4610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]