SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26554223|ref|NP_758157.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26554223|ref|NP_758157.1|
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.84e-35
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00074
Further Details:      
 
Domain Number 2 Region: 166-266
Classification Level Classification E-value
Superfamily PTS system IIB component-like 9.42e-34
Family PTS system, Fructose specific IIB subunit-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|26554223|ref|NP_758157.1|
Sequence length 709
Comment PTS system fructose-specific enzyme IIABC component [Mycoplasma penetrans HF-2]
Sequence
MDIFNKKYIKTNLEVSSKNDALKKISNLAKELGIISSVTDVTNALKAREEESSTGFENGF
AIPHARTKSILKPAILFIKFKKAIDWKSLDKQLTSCAFVLLIPEEVSSVHLDFLSKISTA
LMDKNFVNKIKETNSKDLIYEEINKYFTTEDSATNNSTVSDNSQKRIIALTACPVGVAHT
YLAADKLKEAGKSKNIWIKVETHGSVGIKNQATNEEIQKADAIIVASDIGLDLSRFNNKV
LIQTPIKEAIHNPSELIDKALNSKSIYKSSETKTNNSQKEFNKDEKKKMSVMKHILSGIS
YMIPFVILGGICIALSAGLGKAIYGQDNSAPQGDFFYYLNEIGSVAFTLMIGVLGAYIAY
SIAGRATLAPAFIVSIVGNTPNAIYTFAGIQNDGVGMGFLGSILFGLLIGYTVKWINTWK
IPKSISSIMPIFVIPLGVGLFYGLIAIFVIGAPVAFVMGQFINALKSIFVSGNTSNAVSK
DISLGVSIAIGILIGAMAGFDMGGPINKVAFLTCTALISSNVNEPMGMMAAAIPVAPLGM
GLCTMIFRNKFNKEEKTMGISAFIMGFIGISEGAIPFAISDPKRAIACNVIGSAITGGIA
GALGITCAAAHGGPIVGILGAVSSNQFGLVGGIGLFFVTIIIGMLITCFLYGIIRKRDKN
NNQENFKDVFKIFKRSKNVNKANLYKQEKLFKNQKVLINKTRGNLCLNL
Download sequence
Identical sequences Q8EV00
WP_011077590.1.43808 272633.MYPE7670 gi|26554223|ref|NP_758157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]