SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|26554337|ref|NP_758271.1| from Mycoplasma penetrans HF-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26554337|ref|NP_758271.1|
Domain Number 1 Region: 14-58,101-154
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.49e-22
Family N-utilization substance G protein NusG, N-terminal domain 0.00059
Further Details:      
 
Domain Number 2 Region: 293-346
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000341
Family N-utilization substance G protein NusG, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|26554337|ref|NP_758271.1|
Sequence length 348
Comment transcription antitermination factor [Mycoplasma penetrans HF-2]
Sequence
MENEKFENNNDTVKKDEAKWYIVTSINGNEDTVYKNIEDKVRAYDLGNVVQEMRLLKTRE
ITIEVFDPINNPPPSRFRNTKSITWETLPGGRYKKTRIREINRFPGYIYIKMIMEDDAWY
VIRNTFGVTGFVGSSGKGAKPIPMSDIEVANLFNPEMNQDIIINKTSDVFVEQTVSKPRE
AEKRIEFLDSGNNLVDKDGFFNSNLNQENKGEEASSESTENVESSNVEEVSVSMDQSTNV
EVDTNVENQYLSNHDGEVEEVTINEDVDNKQEEETEEEVELFHKGNSDSKSPLFAVGNTV
EILVESMQGYEGVIESIDLEKDKAKVLVDILGKETIVDVHFSEIRKKI
Download sequence
Identical sequences Q8EUN7
272633.MYPE8840 gi|26554337|ref|NP_758271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]