SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00000111727 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00000111727
Domain Number 1 Region: 171-289
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 9.42e-24
Family Methionine synthase SAM-binding domain 0.032
Further Details:      
 
Domain Number 2 Region: 36-142
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 6.8e-22
Family Cobalamin (vitamin B12)-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00000111727
Sequence length 292
Comment Putative uncharacterized protein GOS_3948852 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096689280557 SV=1
Sequence
IWKRAMMPVEGASCWQRSKATFTILERIWWTSFSPNNGYQVVNIGIKQTINQIIDSALEN
DVDAIGMSGLLVKSTVIMKENLEEITSRGLDQKWPILLGGAALTRPYVEEDLAQMFPGEV
RYARDAFEGLRLMDAIMAIKRGEAGATLPELRQRRVKKVDKSFDSTEIDTQRSDVALDNA
IPVAPFFGSRIVKGIALADYLGMLDERALFVGQWGLKGARGEYAAMVENEGRPRLRKLLN
EVQSQGWLEAAVVYGYFPCVSEGNDLVILHHEGPEKGKERMRFSFPRQSRDR
Download sequence
Identical sequences MES00000111727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]