SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00000342901 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MES00000342901
Domain Number - Region: 151-227
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0471
Family Inorganic pyrophosphatase 0.0088
Further Details:      
 
Domain Number - Region: 83-138
Classification Level Classification E-value
Superfamily Bacterial adhesins 0.0783
Family Pilus subunits 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00000342901
Sequence length 236
Comment Putative uncharacterized protein GOS_6104590 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096674274359 SV=1
Sequence
FILIREWLKESHNEIPDYLNEIIFYVGQNYNFIWQSINQNLLFNGNHLNENYNFDKYLKF
HNYKFKNENNECGGYVILKEKNLILSVDLGSSPEKKFSNDYQSGALSFEVFFKNCKLISN
CGYFQNYKHQLNSISRSSATHSTLVLDNTSSCKFKRDNDGILKINQELKVTKKTIIAEKN
YWCVEGSHEGYLKDYGIIHERKIEHFFDKNKFLGTDKLIKKKKSKNTNFEIRFHFE
Download sequence
Identical sequences MES00000342901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]