SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00000446893 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00000446893
Domain Number 1 Region: 33-93
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000948
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.003
Further Details:      
 
Domain Number 2 Region: 2-31
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000405
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0058
Further Details:      
 
Weak hits

Sequence:  MES00000446893
Domain Number - Region: 97-128
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000837
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00000446893
Sequence length 138
Comment Putative uncharacterized protein GOS_3251949 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096688032935 SV=1
Sequence
LLLILGQLGINLAPLLAGAGVAGIAIGFGAQTFVKDLLVGISVLAEDQYGVGDVINFGEG
SGTVESMTLKSTRVRALDGTLWHLPNGEIARVANMTQGWSRVILDVGVAYASEITFVHER
IQEVLDSLALTDGVGSKF
Download sequence
Identical sequences MES00000446893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]