SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00000471386 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00000471386
Domain Number 1 Region: 86-235
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.27e-42
Family Cobalamin (vitamin B12)-binding domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 5-81
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.31e-25
Family Methionine synthase domain 0.0000732
Further Details:      
 
Domain Number 3 Region: 246-302
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.000000152
Family Methionine synthase SAM-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00000471386
Sequence length 303
Comment Putative uncharacterized protein GOS_4186943 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096668813431 SV=1
Sequence
PVELVTYSLINGIDKYIVEDIENIRTNYESALEIIEGPLMDGMQVVGDLFGSGKMFLPQV
VKSARVMKKAVSYLKPFMENEKTGEGTKRGKIILATVKGDVHDIGKNIVAIVLQCNNYEV
VDLGVMVPAEKILQIAKEESADIIGLSGLITPSLDEMVGIAKEMNRQQLEVPLLIGGATT
SLKHTAVKIAPNYKEPIIRVRDASKVAQVVGNLLSEEKKIEFSNKNRKKQEKLRESFEKS
NNSETISDDIAYKNRLKLDWESEDIAIPSFTGLKHITDFPIEKIREFIDWTFFFKAWQMR
GXX
Download sequence
Identical sequences MES00000471386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]