SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00000859620 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00000859620
Domain Number 1 Region: 3-155
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.76e-51
Family Inorganic pyrophosphatase 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00000859620
Sequence length 156
Comment Putative uncharacterized protein GOS_5632825 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096690808115 SV=1
Sequence
MYNENDDIDVVIEIPYKSNVKYEIKKNELQVDRVLSTAMFYPGNYGYIPHTLAGDGDPVD
VLIINETPFYPTSHIRCKVLGMLFTTDEKGEDQKVLALPISKVDPSYSNINDISDINDSK
LELIKNFYENYKKLEKNKTVTVKDYFNKADTIKFIK
Download sequence
Identical sequences MES00000859620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]