SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001045537 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00001045537
Domain Number 1 Region: 2-193
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.05e-63
Family Phosphoglycerate kinase 0.00000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00001045537
Sequence length 193
Comment Putative uncharacterized protein GOS_6012712 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096674433079 SV=1
Sequence
VMSWKTLCQMDLHGKRVLTRVDLNVPMVDGKIADATRIEKIVPTVNEITKKGGTPILLAH
MGRPKGKRHQNLSLSQLQEDLQTYFGSKVIFAADCIGPSAETALQIVKKGEIILLENTRF
YPEEEENDPNFAASLAAMADLFCNDAFSASHRAHASTTGLAKYLPSCAGKLMEAELKALE
SVLGQPARPVVTV
Download sequence
Identical sequences MES00001045537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]