SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001073826 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MES00001073826
Domain Number - Region: 19-58
Classification Level Classification E-value
Superfamily Hypothetical protein TM0875 0.0196
Family Hypothetical protein TM0875 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00001073826
Sequence length 76
Comment Putative uncharacterized protein GOS_3647254 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096666057101 SV=1
Sequence
ATRLPNYNKVGNIIDCYLAWRGTNYMIKMFFPSVKKPSRREVQDQLQKVYPGSKLWNYQV
SRHEPGEPILQTAGGA
Download sequence
Identical sequences MES00001073826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]