SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001357222 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00001357222
Domain Number 1 Region: 2-110,221-331
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.35e-63
Family Substrate-binding domain of HMG-CoA reductase 0.00000499
Further Details:      
 
Domain Number 2 Region: 102-208
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 7.59e-31
Family NAD-binding domain of HMG-CoA reductase 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00001357222
Sequence length 332
Comment Putative uncharacterized protein GOS_4406155 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096669765989 SV=1
Sequence
MYKLSVQERRKLVAEAAQLSDEHTNALAAHGELDETSADRMIENVIGTMSLPVGVATNFV
IDGKHYLIPFCLEESSVVAAASNMAKRCLGHGGFSTNNDDPIMIGQIQMLDIDNLEQAIA
NIHDEKDELMAFCNDVPSRMIALGGGCKDIEVRQISTPMGNMLIAHLLVDCRDAMGANAV
NTMAERVAPRIEALTGGRAHLRILSNLAGHRLARVHAVFTPEEMAADGSREEGMAVIKGI
LEAHAFAAEDPYRAATHNKGVMNAISSVALACGQDWRAIEAGCHAWTTLSDGRYTSMSDW
TQDDEGNLVGTMELPMAVGIVGGASKVHPAAR
Download sequence
Identical sequences MES00001357222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]