SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001362286 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00001362286
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 3.4e-48
Family Phosphoglycerate kinase 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00001362286
Sequence length 145
Comment Putative uncharacterized protein GOS_4607874 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096670737297 SV=1
Sequence
IFETSKNHSCKISFPIDVLVGKNMGDKSKVKELNDIENDDIILDIGPKTIEKIKNIIENS
KTVLWNGPAGYFENPNFAKGSHEIAKQIVKKNKDSSIYSVIGGGDTIALINQINVIEEFN
FVSTAGGAFLEYLEGKELPGIKALD
Download sequence
Identical sequences MES00001362286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]