SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001365351 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00001365351
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.49e-35
Family Phosphoglycerate kinase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00001365351
Sequence length 97
Comment Putative uncharacterized protein GOS_4736728 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096689679229 SV=1
Sequence
DEIILDIGPKTIELIEKIIENSKTILWNGPAGYFEYPNFAKGSKKIANKIAERNKTGKIF
SVAGGGDTVAAINNFKLTKDFNFISTAGGAFLEFLXX
Download sequence
Identical sequences MES00001365351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]