SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001422483 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MES00001422483
Domain Number - Region: 7-80
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 0.033
Family Phosphoglycerate kinase 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00001422483
Sequence length 202
Comment Putative uncharacterized protein GOS_3539520 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096667856325 SV=1
Sequence
IMNRKKKLRIIQSLLLISGIIVIFFTYLKTNKDIDKILISEERQEKIKKQLLDEKNTSVD
VFYNIEYSGLDLNGNRYNIKSKEAINNPDDIELVNMKFVDAKFYFKDDTVLTIESDKGIY
NNKTLDIEFIGNVKGAYLDSKLFAQKASYSNSKGFVTISDNVKIIDIKGKMIAEKLLFDI
KNKTLDISSNNNSKVKANINLK
Download sequence
Identical sequences MES00001422483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]