SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001524280 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00001524280
Domain Number 1 Region: 137-239
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 1.96e-20
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 68-134
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.22e-16
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.003
Further Details:      
 
Domain Number 3 Region: 15-67
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000000994
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00001524280
Sequence length 247
Comment Putative uncharacterized protein GOS_4070778 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096670432187 SV=1
Sequence
IEKELLSEHRGPRDSDDRATISAVARLARITVWVLSALMVLQSLGVSVSGLLAFGGIGGI
AVGFAAKDMLANFLGGLSIYLDRPFAVGDWIRSPDRSIEGTVEDIGLRVTRIRTFDQRPL
YVPNSTFSSVSLENPSRMTNRRIYETIGVRYEDAGRVAKIVSDVQTMLKEHEDIAQDRTM
IVNFNHMGPSSLDFFIYAFTKTTNWVEYHAIKENVLLQILEIVERNGAEIAFPTHTIHHA
PAEPTEQ
Download sequence
Identical sequences MES00001524280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]