SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001691090 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00001691090
Domain Number 1 Region: 208-305
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 2.22e-16
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 141-205
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000719
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0021
Further Details:      
 
Domain Number 3 Region: 52-139
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000262
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00001691090
Sequence length 305
Comment Putative uncharacterized protein GOS_3707375 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096667457605 SV=1
Sequence
IFFKKISKRTKTNFDDFIFEVISGIIKPIGFLLSFYFSIDYFFADEITFISVLLNILKLF
ILIIIIKALNKVLIRSLTETTSKINDSSISSMVSSLTPLIKALTWTIGSIFFLQNIGVQM
TAIWALLSAGGIGAGLALKDPVQEFFEYITILLDKPFQKGEFIKSDGVLGMVERVGVRSS
RIRSINGEVIVMSNSALTNGIISNYAQMEKRRLVHKLGVVYETSPKLMKLIPIIIKKIVE
ETKDASFDRCHFTDFGDFSLNFELVYYIPTNNYLAAMEAQQSINLRIIEEFAVNNIEFAF
PTQTL
Download sequence
Identical sequences MES00001691090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]