SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00001953510 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00001953510
Domain Number 1 Region: 2-293
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.7e-91
Family Phosphoglycerate kinase 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00001953510
Sequence length 295
Comment Putative uncharacterized protein GOS_3618132 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096666667035 SV=1
Sequence
LSLIPIYKYLKDALKTNVYFFKGTFDDETKEKFSHLKGGEVILIENIRFFKEETEDDQDF
SKKLGELGDIYINDAFSCSHRKQASVYSVTKFVKKSYAGPLLKKEITAINLVVKNKKEPV
TCIIGGSKISTKINVITNLLKKVNNIVIVGAMANNFFVHMNFKVGKSLVEKNTKEIISNI
YKKAEEHNCKILIPEDCIVGTDFEGTGKNKNLDEIKENEIILDIGSNTIKKIQKKINESN
TVLWNGPAGYFENKNFLKGTLSIAENISKNTIEKSLISILGGGDTLAAINKSNDK
Download sequence
Identical sequences MES00001953510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]