SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00002032747 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00002032747
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 9.29e-59
Family Methionine synthase SAM-binding domain 0.00000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00002032747
Sequence length 138
Comment Putative uncharacterized protein GOS_3300712 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096666713607 SV=1
Sequence
IIIQALADRFAEGFAELLHKKVRVHMGFGKEEGLSSEDLIKECYRGIRPAAGYPACPDHT
EKQILWNLLDVEKRTGMQLTTSYAMFPPSSVSGLYFFNEEARYFNVGKIERDQLEDYASR
KGMSIEEAEKWLAPNLAD
Download sequence
Identical sequences MES00002032747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]