SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00002208169 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MES00002208169
Domain Number - Region: 75-133
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0641
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00002208169
Sequence length 153
Comment Putative uncharacterized protein GOS_3844306 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096688979207 SV=1
Sequence
MDTTIARRHTTRRRAIIEALCTKLEQINGSAPFRTSVARVERRLKFWDEVTEFPTIHVGA
GAETREYEGAGFRFRFLRITIRCYVSDDDDVILALEELLEDVESVLEDNDPLGYTDSTGA
SQSTVQTTIATVDTDEGVLEPLGVGEIVCEIRY
Download sequence
Identical sequences MES00002208169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]