SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00002263340 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00002263340
Domain Number 1 Region: 1-284
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.19e-104
Family Phosphoglycerate kinase 0.000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00002263340
Sequence length 290
Comment Putative uncharacterized protein GOS_6554132 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096666421065 SV=1
Sequence
EVVVLENCRFNVGESDNDENLAKKYAALADIFVMDAFGTAHRKQASTYGIAQFCHKVCAG
RLFYSELEALEKVVKNPKTPMVAIVGGSKVSSKLSILDQLADKVDQLILGGGIANTFLKA
QGFNIGNSLHENAFIDSAKKIIQKLESRGASLPLVTDVICGKEFNESEAAVKKNINDLEP
TDMIFDLGPETMKGITQNLKQSKTILWNGPIGVFEFDQFSKGTETLAHAIANSIAFSLAG
GGDTIAALEKFGMINNISYISTAGGAFLEFVEGKKLPAIDILERRATIEH
Download sequence
Identical sequences MES00002263340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]