SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00002382796 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00002382796
Domain Number 1 Region: 122-233
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.96e-29
Family NAD-binding domain of HMG-CoA reductase 0.0035
Further Details:      
 
Domain Number 2 Region: 21-118,231-294
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 1.57e-26
Family Substrate-binding domain of HMG-CoA reductase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00002382796
Sequence length 301
Comment Putative uncharacterized protein GOS_6744118 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096666567013 SV=1
Sequence
MKSQRKMTEEKNGKNSSIPRGYLPEDTRARLEWVKKFTGIEIDDSVLDKEEDLQGIIENH
VGFMKIPMAVVGPMTLNGTYAKGEFCVPVCTLEGTLAMSMNRGMVASSLSGGTNVKHFRQ
ELSRAPVFIFNSLEESAQFQTWVNKNKDKVAAAAESTTKHGKVLRVDQYTVQNYVVLDIV
MDTKNAAGQNMVTLAAKVACELIREETGHSYFLESNINSDKKASVRNMLLGRGHGVTAET
TIKNSVMKKVLKVDPDILFDNWAYYPVFSSMVGTHGVAIHESNALTAIYLATGQMLLVLQ
K
Download sequence
Identical sequences MES00002382796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]