SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00002489242 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00002489242
Domain Number 1 Region: 3-115,226-312
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 5.62e-53
Family Substrate-binding domain of HMG-CoA reductase 0.0000228
Further Details:      
 
Domain Number 2 Region: 107-213
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 2.17e-29
Family NAD-binding domain of HMG-CoA reductase 0.0000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00002489242
Sequence length 312
Comment Putative uncharacterized protein GOS_6913412 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096689843149 SV=1
Sequence
SRLSGFFKLSVAERRKLVQNLSGITDEHVNALANNGELSDEAADRMIENVIGTMSLPVGI
ATNFVVDGKHYLIPFCLEESSVVAAASNMAKRCLIHGGFHSQNDGPLMIGQIQILDTPDI
EDAMRKLNEAREDIIALCNSLPSTMIKLGGGCKRIETRVIETMSGPMLILHIIVDCRDAM
GANAVNTMAELIAPEVERLTNGRVHLKILSNLAAHRLARVEAVFTPQELSNDGSIENGQA
VIDGIIEAHHFAVADPFRATTHNKGVMNAISSVAVACGQDWRAIEAGCHAWSAHANQQYT
SMTKWAVNDDGD
Download sequence
Identical sequences MES00002489242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]