SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00002750488 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00002750488
Domain Number 1 Region: 17-94
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000000000000432
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00002750488
Sequence length 95
Comment Putative uncharacterized protein GOS_7326374 OS=marine metagenome Pep=JCVI_PEP_1096671348211 SV=1
Sequence
MWFIKHHINHLQKFQILLEEIIKKAENARFERANFKSLGDSSLLFEVVFYVSVPGNDYIE
YMNIIQNINYAIFKKFEDEKIDFAYPTQTLHIAKE
Download sequence
Identical sequences MES00002750488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]