SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00002896701 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00002896701
Domain Number 1 Region: 1-298
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 9.19e-83
Family Phosphoglycerate kinase 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00002896701
Sequence length 298
Comment Putative uncharacterized protein GOS_7563193 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096673804829 SV=1
Sequence
TIEHALSNNARILLISHLGRPSEGNFEEKFSLQPVAEYISNLFNEKCELINSLESKDIFN
GKFNVQLLENIRFFEGEKSDSAKLGKILASLGDIYVFDAFGTAHREQASTHSAIEQANIA
CAGFLLERENRNLTKVLNNYENPYIAVIGGAKVSTKLELIKSINNEAQNIIVGGGIANTF
IKAAGFKIGQSLYEESMLDIAKSILEKNKIVLPDKVITSETFEGKNIQKKSLDEIEDNEM
ILDLLLKEETYSILDSAKTILWNGPMGVFENKLFEQGTRDLSETIAKSSAFSIAGGGE
Download sequence
Identical sequences MES00002896701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]