SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00003163860 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00003163860
Domain Number 1 Region: 257-361
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000000209
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 187-253
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000000327
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.002
Further Details:      
 
Domain Number 3 Region: 107-186
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000288
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00003163860
Sequence length 365
Comment Putative uncharacterized protein GOS_7987349 OS=marine metagenome Pep=JCVI_PEP_1096677774261 SV=1
Sequence
MNIIDNFTNLFSDVWGKGVAGVNFSEISLALIIFLFFLVFRGLFTKIIISRLEKFVSKSS
NRFDNTLVKSLEGPVRFLPVVIGFFIATNYINVAGKASYFIDSFNRSLITVLIFWTMHQI
VEPVSYLIKKIEDLLSRDLLNWILRALKILIFILGLAAVLEIWGIKIGPVIARLGLFGVA
VALGAQDLFKNLISGILVLVEKRFKIGDWIFVEGIIEGTVEKIGFRSTVIRKFDKSLAII
PNFQFAEKAVINNTEITNRRIDWLIGLEYSSTSEQLIKCRDQIEKHIQSSSDFIVSENTK
LIVKLVQFSASSIDIRVRAFTKTSDYHECINVKDRLVIAIKEIIEKNGASFAFPSQSIYV
EKLEK
Download sequence
Identical sequences MES00003163860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]