SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00003175029 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00003175029
Domain Number 1 Region: 11-182
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 3.53e-53
Family Phosphoglycerate kinase 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00003175029
Sequence length 182
Comment Putative uncharacterized protein GOS_8006282 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096676034447 SV=1
Sequence
MSSQDFLMNSIKDHENLNHKKILLRLDLNVPLKNGVITDHTRIDKILPIIDFLLNKNSKI
IVISHVGRPKGKVNKDLSLKPICESLEKKIDKKIKIIDKDVFKLKKDDLFKDPKDQIIFL
ENIRFYEEEEKNDLNFSKHLARLADMYVNDAFSCSHRAHASVCKITEFLPSFAGLQLEKE
IK
Download sequence
Identical sequences MES00003175029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]