SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00003187435 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00003187435
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.28e-65
Family Methionine synthase SAM-binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00003187435
Sequence length 168
Comment Putative uncharacterized protein GOS_8027618 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096695164267 SV=1
Sequence
GKERTRFTFPRQTRDRRLCISDFFAAKDSGKTDVVAFHVVTMGSTVSDAAAKLFAANNYR
EYLELHGLSVQLTESLAEHWHARIREELSVKSDDSNDLQGILDQGYRGSRYSFGYPACPD
LEQQVQLCELLEPGRIGVELSEEFQLHPEQSTSAIIVHHPEAKYFNAN
Download sequence
Identical sequences MES00003187435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]