SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00003355677 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00003355677
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.71e-86
Family Phosphoglycerate kinase 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00003355677
Sequence length 242
Comment Putative uncharacterized protein GOS_8307835 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096693997521 SV=1
Sequence
TYGIAKFAKIACAGPLLAAEIDAITKALASPKRPLVAIVAGSKVSTKLTILQALAGKVDG
LIVGGGIANTFMLAAGLKIGKSLAEPDLIDQAKAVIEAMKARGAAVPIPVDVVCAKKFAA
DAEATVKAATDVADDDLILDIGPKTAAMLAEQLKAAGTIVWNGPVGVFEFDAFAHGTETL
ARAIAASSAFSIAGGGDTLAAIAKYGIEKDVGYISTGGGAFLEVLEGKTLPAFEILSQRA
AG
Download sequence
Identical sequences MES00003355677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]