SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00003813762 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00003813762
Domain Number 1 Region: 47-148
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 2.09e-17
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 5-43
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000222
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00003813762
Sequence length 150
Comment Putative uncharacterized protein GOS_9058828 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096678473261 SV=1
Sequence
RLRIIEGIVEKIGFRSTTIRKFDKSLAIIPNFQFAENAVVNVSETSNWLISWIITLQYDT
TVDQLKKIRDEIESHINSSEDYNTSIGVAVRVDKFSDSSIDMYVRCFTKTGSWNNWLDVK
ERLAIAIKEIVEKNGASFAFPSQSIYVEKK
Download sequence
Identical sequences MES00003813762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]