SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00003858233 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00003858233
Domain Number 1 Region: 188-255
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000049
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0021
Further Details:      
 
Domain Number 2 Region: 108-187
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000432
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0091
Further Details:      
 
Domain Number 3 Region: 259-322
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000405
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00003858233
Sequence length 324
Comment Putative uncharacterized protein GOS_9133722 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096679173851 SV=1
Sequence
MMEVFNNFKDLFLSVWQKGILGIDFFQIIIGLGIFFLFLIFRSLISKLIIKKLELISKKT
TNKLDDTFVKAMEGPARFLPIVLGVFFASYYMSFSEENRSFIENINRTLITILIFWIIHQ
IIEPVSYILSGLDKILTRELIGWIIKSLKILIFILGAAAVLELWGIKIGPIIAGLGLFGV
AVALGAQDLFKNLISGILVLVEKRFKMGDWILVEGIIEGIVEKIGFRSTVIRKFDRSLAI
IPNFQFAENAVINVSQTTNWLISWMITLQYDTTVEQLKTIRNQIEEHININEDFDTSIGV
AVRVDKFSDSSIDMYVRCFSKTSE
Download sequence
Identical sequences MES00003858233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]