SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00003924342 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00003924342
Domain Number 1 Region: 34-99
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 7.85e-17
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0014
Further Details:      
 
Domain Number 2 Region: 102-204
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000000105
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0049
Further Details:      
 
Domain Number 3 Region: 2-33
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000112
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00003924342
Sequence length 261
Comment Putative uncharacterized protein GOS_9246432 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096680662821 SV=1
Sequence
VGILFVLQNLDINVSSLIAGLGLGGLAIALAAQDTVRNLLGGVTIFADKPFEVGDWVVVD
GVEGTVEAVGFRSTRVRTFYNSLISVPNGNLMDSGIDNMGQRRWRRYKTTLGVAYHTKPD
QLQAFVEGIRAIIQANPGMRQDYYIVEFHGFGATSLDILVYCFIDAEDWNEELRTRHVLN
LDIMRLAESLQVEFAFPTQTLHIAKMPGQPQQLPEIPDRTDLRNVINSFGPGGSSGQRID
QPITDGHESVLESPYAQADEG
Download sequence
Identical sequences MES00003924342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]