SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004173731 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004173731
Domain Number 1 Region: 31-71
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0000222
Family Inorganic pyrophosphatase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00004173731
Sequence length 74
Comment Putative uncharacterized protein GOS_9662716 OS=marine metagenome Pep=JCVI_PEP_1096695999351 SV=1
Sequence
MLFLPTTSAWITSRAGKILVIIGRKRPLLLEHYKDLKKPGTCTVNGFFGTEKAVEIIKSC
EARYMAEIDPKLVD
Download sequence
Identical sequences MES00004173731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]