SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004214446 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004214446
Domain Number 1 Region: 2-31
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000641
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00004214446
Sequence length 69
Comment Putative uncharacterized protein GOS_9731134 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096696739607 SV=1
Sequence
AFAVGSDLRQAIWTAFDKNGIGIPFPQRQVYPMEWPPSKEQTHRIGSPTNQLQAEADSDP
ANDSAGETP
Download sequence
Identical sequences MES00004214446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]