SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004226923 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MES00004226923
Domain Number - Region: 73-200
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00445
Family Cgl1923-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00004226923
Sequence length 215
Comment Putative uncharacterized protein GOS_9752075 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096679329763 SV=1
Sequence
FLTAKKQNNYPLILPLQMILPFIMEQAEAMKEAIPAFKSGQPVGDGIGPMVVGKMMLETE
KETVALETSLSKTDFENRHLFLLKAQGPGSTVGRPADGLEKIVSENNVDAIIMIDAALKM
EGEDSATVAQGFGAAIGGIGTERFQIEAIASDKNIPIFSIVVKQTIKEAIALMTKEIADT
AEDVRSQVHEMIRENTEEGQSVVIIGVGNTSGVPQ
Download sequence
Identical sequences MES00004226923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]