SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004317425 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004317425
Domain Number 1 Region: 30-192
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.92e-52
Family Inorganic pyrophosphatase 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00004317425
Sequence length 204
Comment Putative uncharacterized protein GOS_9902533 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096697291631 SV=1
Sequence
LVFFLKDHSFKELVSIIKWSIKMDISSIPPSPKKGIVNLIVEIPAGSRNKYEYCSDAGIM
ALDRILHSSVRYPFDYGFIPNTLADDGAPLDAMIIMDEPTFAGCLIKARPIGVLDMHDCG
EYDGKLLCVPLANGRQNNIVSIQQIAASQLEDVAEFFRTSKGLEGRTVQIDGWRDYDVVE
QLIQKCTPNKKKTFKVLKKTKTTI
Download sequence
Identical sequences MES00004317425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]