SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004594508 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004594508
Domain Number 1 Region: 7-73
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.57e-21
Family Phosphoglycerate kinase 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00004594508
Sequence length 73
Comment Putative uncharacterized protein GOS_334441 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096686638013 SV=1
Sequence
MMKSIKDEKNLNNKKILLRLDLNVPLDGDVITDSTRIDKILPTLEFLISQNAKIIIISHV
GRPKGKVIDVLSL
Download sequence
Identical sequences MES00004594508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]