SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004601272 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004601272
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000000102
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00004601272
Sequence length 72
Comment Putative uncharacterized protein GOS_346422 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096700277169 SV=1
Sequence
IWNDSHEVHFNNMGAYSLDILVNIFFDVTTWTEELTARHTFLMNVMKLGEELGVEFAFPT
QTLHVESLPTKP
Download sequence
Identical sequences MES00004601272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]