SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004602140 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004602140
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.3e-85
Family Phosphoglycerate kinase 0.000000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00004602140
Sequence length 251
Comment Putative uncharacterized protein GOS_347958 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096701265871 SV=1
Sequence
MNLCTLDNADLSGKKVLVRLDLNVPVNDRREITDETRIKRSVPTLLDIIKKGGVPVVLSH
FGRPKGKFVAGMSLRFLAEALGQQCGCKVHFGDDSVGAAAKKAVASTLQGDICLLENTRF
HPGEEGNDPVHAKAMAELGDIFVADAFSCAHRAHASTAGLADYLPTYAGRAMEAELRALE
SALANPARPVVAVVGGAKISTKLPVLRHLVSKVDQLVIGGGMANTFLLANGHDVGASLKE
EDMMDMVAEVR
Download sequence
Identical sequences MES00004602140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]