SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004606231 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004606231
Domain Number 1 Region: 30-133
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000000523
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00004606231
Sequence length 139
Comment Putative uncharacterized protein GOS_354968 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096686596115 SV=1
Sequence
RSTRLRTFYNSQVTMSNAKLADLDIDNLGRRQVRRFRTNIGLTYDTPTDKIQAFVEGVRK
VVEDTPEIWNDSHEVHFNNMGAYSLDILVNIFFDVTTWTEELTARHTFLMNVMKLGEELG
VEFAFPTQTLHVESLPTKP
Download sequence
Identical sequences MES00004606231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]