SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004682447 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004682447
Domain Number 1 Region: 251-316
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000118
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.002
Further Details:      
 
Domain Number 2 Region: 318-396
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000000000000123
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0041
Further Details:      
 
Domain Number 3 Region: 170-249
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000000994
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0058
Further Details:      
 
Weak hits

Sequence:  MES00004682447
Domain Number - Region: 103-145
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0314
Family Poly(A) polymerase, PAP, middle domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00004682447
Sequence length 397
Comment Putative uncharacterized protein GOS_464921 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096680683397 SV=1
Sequence
MNKFDFIKNNLNVDYLLSVSFFMQAATLIVAGFVVFLTNKWIMRKIVERSKGNWKALGEG
IGKIVSPFIFLIVVWLSGCILMPYQTVNMLHVIQTILIALIVIRLVVYLVKYILHPNPLL
NAYQNFLSSILWVTVVLHLFGFLAPISSSLQSITFGFGDKEFSVLLVLQLLAGIFLSVIS
AMTLSRFIENRLMKVTQIGLSGRVMINKIVRIALYVIAIVVALDTIGLDLTFLSVFGGAF
GVGLAFGMQKIASNYVSGFTILLDKSLQIGDILTIGEHYGIVDSIKSRYTVLRKLDGVEV
IIPNETLIAENIINHTSSDRKVRVWIDIQVGYSSSVDLATEIMLSSCNQQERVIKDEPEP
TVYLMNFGESGIDLKLVFYIEDAEEGTYRLKSDINKE
Download sequence
Identical sequences MES00004682447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]