SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004731485 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004731485
Domain Number 1 Region: 7-250
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 3.42e-62
Family Phosphoglycerate kinase 0.0000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00004731485
Sequence length 267
Comment Putative uncharacterized protein GOS_548187 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096682944347 SV=1
Sequence
MGLNVSDVLTLDDVRLGGKVVLYRVDVNSPLEPSSGAFLDDSRLRAIIPTLRTLQNSKVV
MLGHQSRPGKIDFTNMEQHADRISRLIGKKVKFISDICGDEAISSIKNLKIGEMLFLDNI
RMHDDENSMKKASLEETAQSEIVRKLSSVIDVYVTDAFAASHRNSPSLTGFYDSVPCIAG
HLMSKEISNLQIAVNDPPRPYIAILGGTKCDDSLKVAKNLIDKEIIDTIPVVGVVGNMML
WASGVDIGEGNKSFIRNVLGDDFQDTW
Download sequence
Identical sequences MES00004731485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]