SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004820422 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004820422
Domain Number 1 Region: 114-210
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 3.92e-25
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00089
Further Details:      
 
Domain Number 2 Region: 39-105
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000000111
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0014
Further Details:      
 
Weak hits

Sequence:  MES00004820422
Domain Number - Region: 3-38
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00106
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00004820422
Sequence length 216
Comment Putative uncharacterized protein GOS_707821 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096697214907 SV=1
Sequence
ITIGLFGAYFIFLSWNININGILASAGVLGVVLGLAAKDTVSNFFAGVFLMADSPFKEGD
YIMLETGERGYVKNMGLRSTRFMTRDDIEITIPNSVIAAAKIINESGGSGVEDIERVRIS
LQVSYDSDIDKVKNILKSIAISNDDVLNDPDPRVRFREFADSGIRLELLFWIYKPETRGR
TVDAVNTEIYKQFKSEGVTIPYPTMNVVMPKRETSS
Download sequence
Identical sequences MES00004820422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]